PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G34560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 405aa    MW: 43472.3 Da    PI: 6.3096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G34560.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEde+l +++++ G g+W++ ++  g++R++k+c++rw +yl
  ORUFI02G34560.1 14 KGPWTTEEDEKLMEYIQKNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.42.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E + ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  ORUFI02G34560.1  67 RGKFTSAEKDTILQLHAVLGNK-WSAIAKHLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.901961IPR017930Myb domain
SuperFamilySSF466891.58E-3111108IPR009057Homeodomain-like
SMARTSM007176.5E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001679.49E-111661No hitNo description
PROSITE profilePS5129425.32962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2765117IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002494.8E-1567112IPR001005SANT/Myb domain
CDDcd001671.97E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTTE EDEKLMEYIQ KNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF TSAEKDTILQ LHAVLGNKWS AIAKHLPGRT DNEIKNYWNT HLKKDLIQKG  120
IDPTTHRPRT DFFAALPQLI ALANLRQLVG QLPWDDPAAA AAGLQQAEAA QAAKFGQYLH  180
LQALLQPPPP SAATSPRSGC IGGAAAAMPG GDMEQMGAGL LSPPAMSSAA LSPMSTSSLS  240
PLPSPMSSTA LSPLPPSSFF GNGGQGSFLA GQLPNIQMHG SSLFDQSAAI INDANHNQDY  300
AASTGEREII NGATKTTTTT LLPEGSLPPL ADYPTISNLG DVYSTPSCDG NITEFPLLPD  360
ALFDELMRDY ISNCFLEDWK VTLLTNMAKP PGLAYETDDG SRMAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0050120.0AP005012.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0627E03.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623220.10.0PREDICTED: myb-related protein Zm38
TrEMBLA0A0E0NL440.0A0A0E0NL44_ORYRU; Uncharacterized protein
STRINGLOC_Os02g51799.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0284500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-90myb domain protein 93